You have no items in your shopping cart.
Cart summary
POU2F1 Peptide - N-terminal region
Catalog Number: orb1998423
| Catalog Number | orb1998423 |
|---|---|
| Category | Proteins |
| Description | POU2F1 Peptide - N-terminal region |
| Predicted Reactivity | Human |
| Form/Appearance | Lyophilized powder |
| Buffer/Preservatives | Lyophilized powder |
| Protein Sequence | Synthetic peptide located within the following region: SLQAAAQSLNVQSKSNEESGDSQQPSQPSQQPSVQAAIPQTQLMLAGGQI |
| UniProt ID | P14859 |
| MW | 84 kDa |
| Storage | Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles. |
| Alternative names | OCT1, OTF1, oct-1B |
| Note | For research use only |
| NCBI | NP_001185712.1 |
| Expiration Date | 6 months from date of receipt. |
