POU1F1 Rabbit Polyclonal Antibody

• Catalog Number: orb324376
• Category: Antibodies
• Description: Rabbit polyclonal antibody to POU1F1
• Species/Host: Rabbit
• Clonality: Polyclonal
• Tested applications: IHC, WB
• Predicted Reactivity: Bovine, Canine, Equine, Goat, Guinea pig, Mouse, Rabbit, Rat, Sheep, Zebrafish
• Reactivity: Human
• Immunogen: The immunogen is a synthetic peptide directed towards the C terminal region of human POU1F1
• Concentration: 0.5 mg/ml
• Form/Appearance: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Conjugation: Unconjugated
• MW: 33kDa
• Target: POU1F1
• UniProt ID: P28069
• Protein Sequence: Synthetic peptide located within the following region: QEIMRMAEELNLEKEVVRVWFCNRRQREKRVKTSLNQSLFSISKEHLECR
• NCBI: NP_000297
• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Buffer/Preservatives: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Alternative names: anti PIT1 antibody, anti CPHD1 antibody, anti GHF-
• Note: For research use only
• Expiration Date: 12 months from date of receipt.

Sample Tissue: Human HT1080 Whole Cell, Antibody Dilution: 1 ug/mL.

Rabbit Anti-POU1F1 Antibody, Paraffin Embedded Tissue: Human Liver, Cellular Data: Hepatocyte, Antibody Concentration: 4.0-8.0 ug/mL, Magnification: 400X.

Rabbit Anti-POU1F1 Antibody, Paraffin Embedded Tissue: Human pituitary, Observed staining: Nuclear, Primary Antibody Dilution: 1:600, Conditions: Primary antibody incubation at RT for 1 hour. Detection was done using HRP -polymer conjugated anti-rabbit secondary antibody by incubating for 30 minutes at RT, Chromogen: DAB, Counterstaining: Hematoxylin.

WB Suggested Anti-POU1F1 Antibody Titration: 0.2-1 ug/mL, ELISA Titer: 1:12500, Positive Control: HepG2 cell lysate.