Queen's Award Received in 2021 ISO 9001 Certified Delivered over 1,000,000 bio-reagents to life science researchers Trusted by Life Science Communities
Cart summary

You have no items in your shopping cart.

POU1F1 Rabbit Polyclonal Antibody

SKU: orb324376

Description

POU1F1 Rabbit Polyclonal Antibody is an unconjugated, affinity purified antibody for the detection of POU1F1. It is suitable for IHC, WB applications. The immunogen is a synthetic peptide directed towards the C terminal region of human POU1F1. This antibody reacts with Human samples and is predicted to react with Bovine, Canine, Equine, Goat, Guinea pig, Mouse, Rabbit, Rat, Sheep, Zebrafish. It is supplied as a liquid in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Research Area

Epigenetics & Chromatin, Molecular Biology, Stem Cell & Developmental Biology

Images & Validation

Tested ApplicationsIHC, WB
ReactivityHuman
Predicted ReactivityBovine, Canine, Equine, Goat, Guinea pig, Mouse, Rabbit, Rat, Sheep, Zebrafish

Related Conjugates & Formulations

Key Properties

HostRabbit
ClonalityPolyclonal
ImmunogenThe immunogen is a synthetic peptide directed towards the C terminal region of human POU1F1
TargetPOU1F1
Protein SequenceSynthetic peptide located within the following region: QEIMRMAEELNLEKEVVRVWFCNRRQREKRVKTSLNQSLFSISKEHLECR
Molecular Weight33kDa
PurificationAffinity Purified
ConjugationUnconjugated

Storage & Handling

StorageMaintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
Buffer/PreservativesLiquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Concentration0.5 mg/ml
Expiration Date12 months from date of receipt.
DisclaimerFor research use only

Alternative Names

anti PIT1 antibody, anti CPHD1 antibody, anti GHF-1 antibody, anti Pit-1 antibody, anti POU1F1a antibody

Similar Products

  • POU1F1 Rabbit Polyclonal Antibody [orb324375]

    WB

    Bovine, Canine, Equine, Goat, Guinea pig, Mouse, Porcine, Rabbit, Rat, Sheep

    Human

    Rabbit

    Polyclonal

    Unconjugated

    100 μl
  • POU1F1 Rabbit Polyclonal Antibody [orb324414]

    WB

    Bovine, Canine, Equine, Goat, Guinea pig, Mouse, Rabbit, Rat, Sheep

    Human

    Rabbit

    Polyclonal

    Unconjugated

    100 μl
  • POU1F1 Rabbit Polyclonal Antibody (Biotin) [orb2143416]

    IHC,  WB

    Bovine, Canine, Equine, Goat, Guinea pig, Human, Mouse, Rabbit, Rat, Sheep, Zebrafish

    Rabbit

    Polyclonal

    Biotin

    100 μl
  • POU1F1 Rabbit Polyclonal Antibody (HRP) [orb2143418]

    IHC,  WB

    Bovine, Canine, Equine, Goat, Guinea pig, Human, Mouse, Rabbit, Rat, Sheep, Zebrafish

    Rabbit

    Polyclonal

    HRP

    100 μl
  • POU1F1 Rabbit Polyclonal Antibody (FITC) [orb2143420]

    IHC,  WB

    Bovine, Canine, Equine, Goat, Guinea pig, Human, Mouse, Rabbit, Rat, Sheep, Zebrafish

    Rabbit

    Polyclonal

    FITC

    100 μl
Quality Guarantee

Quality Guarantee

Explore bioreagents carefree to elevate your research. All our products are rigorously tested for performance. If a product does not perform as described on its datasheet, our scientific support team will provide expert troubleshooting, a prompt replacement, or a refund. For full details, please see our Terms & Conditions and Buying Guide. Contact us at [email protected].

POU1F1 Rabbit Polyclonal Antibody

Sample Tissue: Human HT1080 Whole Cell, Antibody Dilution: 1 ug/mL.

POU1F1 Rabbit Polyclonal Antibody

Rabbit Anti-POU1F1 Antibody, Paraffin Embedded Tissue: Human Liver, Cellular Data: Hepatocyte, Antibody Concentration: 4.0-8.0 ug/mL, Magnification: 400X.

POU1F1 Rabbit Polyclonal Antibody

Rabbit Anti-POU1F1 Antibody, Paraffin Embedded Tissue: Human pituitary, Observed staining: Nuclear, Primary Antibody Dilution: 1:600, Conditions: Primary antibody incubation at RT for 1 hour. Detection was done using HRP -polymer conjugated anti-rabbit secondary antibody by incubating for 30 minutes at RT, Chromogen: DAB, Counterstaining: Hematoxylin.

POU1F1 Rabbit Polyclonal Antibody

WB Suggested Anti-POU1F1 Antibody Titration: 0.2-1 ug/mL, ELISA Titer: 1:12500, Positive Control: HepG2 cell lysate.

UniProt Details

No UniProt data available

NCBI Reference Sequences

Associated Accession Numbers
Curated reference sequences for the gene transcript and protein product
ProteinNP_000297

Documents Download

Datasheet
Product Information
Download

Request a Document

Protocol Information

WB
Western Blot (IB, immunoblot)
View Protocol
IHC
Immunohistochemistry
View Protocol

POU1F1 Rabbit Polyclonal Antibody (orb324376)

  • Star
  • Star
  • Star
  • Star
  • Star
  • 0.0
Based on 0 reviews

Participating in our Biorbyt product reviews program enables you to support fellow scientists by sharing your firsthand experience with our products.

Login to Submit a Review

No reviews yet

Available Sizes

Select a size below

100 μl
$ 620.00
Free Secondary Antibody (20 ul)0/0

Please add an antibody product to your cart first.

DispatchUsually dispatched within 1 - 2 weeks
Bulk Enquiry