POU1F1 Rabbit Polyclonal Antibody

• Catalog Number: orb324375
• Category: Antibodies
• Description: Rabbit polyclonal antibody to POU1F1
• Species/Host: Rabbit
• Clonality: Polyclonal
• Tested applications: WB
• Predicted Reactivity: Bovine, Canine, Equine, Goat, Guinea pig, Mouse, Porcine, Rabbit, Rat, Sheep
• Reactivity: Human
• Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human POU1F1
• Concentration: 1.0 mg/ml
• Form/Appearance: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Conjugation: Unconjugated
• MW: 33kDa
• Target: POU1F1
• UniProt ID: P28069
• Protein Sequence: Synthetic peptide located within the following region: TPCLYKFPDHTLSHGFPPIHQPLLAEDPTAADFKQELRRKSKLVEEPIDM
• NCBI: NP_000297
• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Buffer/Preservatives: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Alternative names: anti PIT1 antibody, anti CPHD1 antibody, anti GHF-
• Note: For research use only
• Expiration Date: 12 months from date of receipt.

WB Suggested Anti-POU1F1 Antibody Titration: 1.0 ug/mL, ELISA Titer: 1:312500, Positive Control: Jurkat cell lysate.