POTEA Rabbit Polyclonal Antibody

• Catalog Number: orb587711
• Category: Antibodies
• Description: Rabbit polyclonal antibody to POTEA
• Target: POTEA
• Clonality: Polyclonal
• Species/Host: Rabbit
• Conjugation: Unconjugated
• Reactivity: Human
• Predicted Reactivity: Yeast
• Form/Appearance: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Concentration: 0.5 mg/ml
• Buffer/Preservatives: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Purification: Affinity Purified
• Immunogen: The immunogen is a synthetic peptide directed towards the C-terminal region of Human POTEA
• Protein Sequence: Synthetic peptide located within the following region: EKVTQEPDINKDCDREVEEEMQKHGSNNVGLSENLTDGAAAGNGDGGLVP
• UniProt ID: Q6S8J7
• MW: 56kDa
• Tested applications: WB
• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Alternative names: A26A1, POTE8, POTE-8, CT104.3
• Note: For research use only
• NCBI: NP_001005365
• Expiration Date: 12 months from date of receipt.

Sample Tissue: Human Jurkat Whole Cell, Antibody Dilution: 1 ug/ml.