POR Rabbit Polyclonal Antibody

• Catalog Number: orb579141
• Category: Antibodies
• Description: Rabbit polyclonal antibody to POR
• Target: POR
• Clonality: Polyclonal
• Species/Host: Rabbit
• Conjugation: Unconjugated
• Reactivity: Human
• Predicted Reactivity: Bovine, Canine, Equine, Guinea pig, Mouse, Rabbit, Rat, Yeast, Zebrafish
• Form/Appearance: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Concentration: 1.0 mg/ml
• Buffer/Preservatives: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Purification: Protein A purified
• Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human POR
• Protein Sequence: Synthetic peptide located within the following region: IDNALVVFCMATYGEGDPTDNAQDFYDWLQETDVDLSGVKFAVFGLGNKT
• UniProt ID: Q63HL4
• MW: 77kDa
• Tested applications: IHC, WB
• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Alternative names: CPR, CYPOR, P450R
• Research Area: Cell Biology, Epigenetics & Chromatin, Immunology
• Note: For research use only
• NCBI: NP_000932

Human Muscle

WB Suggested Antibody Titration: 2.5 ug/ml, Positive Control: 293T.