POLR3H Rabbit Polyclonal Antibody

SKU: orb580432

Description

POLR3H Rabbit Polyclonal Antibody is an unconjugated, affinity purified antibody for the detection of POLR3H. It is suitable for WB application. The immunogen is a synthetic peptide directed towards the middle region of human POLR3H. This antibody reacts with Human samples and is predicted to react with Bovine, Canine, Equine, Mouse, Rabbit, Rat. It is supplied as a liquid in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Research Area

Signal Transduction

Images & Validation

• Tested Applications: WB
• Reactivity: Human
• Predicted Reactivity: Bovine, Canine, Equine, Mouse, Rabbit, Rat

Key Properties

• Host: Rabbit
• Clonality: Polyclonal
• Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human POLR3H
• Target: POLR3H
• Protein Sequence: Synthetic peptide located within the following region: AHDLYMDTGEEIRFRVVDESFVDTSPTGPSSADATTSSEELPKKEAPYTL
• Molecular Weight: 20kDa
• Purification: Affinity Purified
• Conjugation: Unconjugated

Storage & Handling

• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Buffer/Preservatives: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Concentration: 0.5 mg/ml
• Expiration Date: 12 months from date of receipt.
• Disclaimer: For research use only

Alternative Names

C25, RPC8, RPC22.9

Quick Database Links

Gene Symbol

POLR3H

UniProt

B0QYH9

RefSeq (Protein):NP_001018062