You have no items in your shopping cart.
Cart summary
Item 1 of 1
POLR3C Rabbit Polyclonal Antibody
Catalog Number: orb581606
| Catalog Number | orb581606 |
|---|---|
| Category | Antibodies |
| Description | Rabbit polyclonal antibody to POLR3C |
| Species/Host | Rabbit |
| Clonality | Polyclonal |
| Tested applications | WB |
| Predicted Reactivity | Bovine, Canine, Equine, Guinea pig, Mouse, Rabbit, Rat, Yeast |
| Reactivity | Human |
| Immunogen | The immunogen is a synthetic peptide directed towards the middle region of human POLR3C |
| Concentration | 0.5 mg/ml |
| Form/Appearance | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Conjugation | Unconjugated |
| MW | 60kDa |
| Target | POLR3C |
| UniProt ID | Q9BUI4 |
| Protein Sequence | Synthetic peptide located within the following region: VEAIIASMQATGAEEAQLQEIEEMITAPERQQLETLKRNVNKLDASEIQV |
| NCBI | NP_006459 |
| Storage | Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles. |
| Buffer/Preservatives | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Alternative names | C82, RPC3, RPC62 Read more... |
| Note | For research use only |
| Expiration Date | 12 months from date of receipt. |
WB Suggested Anti-POLR3C Antibody Titration: 0.2-1 ug/ml, ELISA Titer: 1:12500, Positive Control: 293T cell lysate. POLR3C is strongly supported by BioGPS gene expression data to be expressed in Human HEK293T cells.
- Item 1 of 2
POLR3C Rabbit Polyclonal Antibody [orb312535]
IF, IHC-Fr, IHC-P, WB
Human
Rabbit
Polyclonal
Unconjugated
100 μl, 200 μl, 50 μl - Item 1 of 3
- Item 1 of 2
- Item 1 of 1
Anti-POLR3C Antibody [orb215005]
WB
Human, Mouse, Rat
Rabbit
Polyclonal
Unconjugated
30 μl, 100 μl, 200 μl - Item 1 of 1
