POLR2H monoclonal antibody (M01), clone 3G6-1A4

• Catalog Number: orb2292375
• Category: Antibodies
• Description: Mouse monoclonal antibody raised against a full length recombinant POLR2H.
• Species/Host: Mouse
• Clonality: Monoclonal
• Clone Number: 3G6-1A4
• Tested applications: ELISA, WB
• Reactivity: Human
• Isotype: IgG1 Kappa
• Immunogen: POLR2H (AAH00739, 1 a.a. ~ 150 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
• Conjugation: Unconjugated
• Protein Sequence: MAGILFEDIFDVKDIDPEGKKFDRVSRLHCESESFKMDLILDVNIQIYPVDLGDKFRLVIASTLYEDGTLDDGEYNPTDDRPSRADQFEYVMYGKVYRIEGDETSTEAATRLSAYVSYGGLLMRLQGDANNLHGFEVDSRVYLLMKKLAF
• NCBI: AAH00739
• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Buffer/Preservatives: In 1x PBS, pH 7.4
• Note: For research use only
• Expiration Date: 12 months from date of receipt.

Detection limit for recombinant GST tagged POLR2H is approximately 0.3 ng/ml as a capture antibody.

POLR2H monoclonal antibody (M01), clone 3G6-1A4 Western Blot analysis of POLR2H expression in Hela.

POLR2H monoclonal antibody (M01), clone 3G6-1A4. Western Blot analysis of POLR2H expression in HepG2.

Western Blot analysis of POLR2H expression in transfected 293T cell line by POLR2H monoclonal antibody (M01), clone 3G6-1A4. Lane 1: POLR2H transfected lysate (17.1 KDa). Lane 2: Non-transfected lysate.

Western Blot detection against Immunogen (42.24 KDa).