POGZ Rabbit Polyclonal Antibody

• Catalog Number: orb576989
• Category: Antibodies
• Description: Rabbit polyclonal antibody to POGZ
• Species/Host: Rabbit
• Clonality: Polyclonal
• Tested applications: IHC, WB
• Predicted Reactivity: Bovine, Canine, Equine, Guinea pig, Mouse, Rabbit, Rat
• Reactivity: Human
• Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human POGZ
• Concentration: 1.0 mg/ml
• Form/Appearance: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Conjugation: Unconjugated
• MW: 155kDa
• Target: POGZ
• UniProt ID: Q7Z3K3
• Protein Sequence: Synthetic peptide located within the following region: EELEPWQKISDVIEDSVVEDYNSVDKTTTVSVSQQPVSAPVPIAAHASVA
• NCBI: NP_055915
• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Buffer/Preservatives: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Alternative names: MRD37, WHSUS, ZNF635, ZNF280E, ZNF635m
• Note: For research use only
• Expiration Date: 12 months from date of receipt.

Sample Tissue: Human HCT116 Whole Cell, Antibody Dilution: 5 ug/ml.

Human kidney

Human Lung

WB Suggested Anti-POGZ Antibody Titration: 5.0 ug/ml, ELISA Titer: 1:62500, Positive Control: Human brain.