PNRC2 Rabbit Polyclonal Antibody

SKU: orb583417

Description

Rabbit polyclonal antibody to PNRC2

Research Area

Epigenetics & Chromatin

Images & Validation

• Tested Applications: WB
• Reactivity: Human
• Predicted Reactivity: Bovine, Canine, Equine, Guinea pig, Mouse, Rabbit, Rat, Zebrafish

Key Properties

• Host: Rabbit
• Clonality: Polyclonal
• Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human PNRC2
• Target: PNRC2
• Protein Sequence: Synthetic peptide located within the following region: NQSWNSSLSGPRLLFKSQANQNYAGAKFSEPPSPSVLPKPPSHWVPVSFN
• Molecular Weight: 15kDa
• Purification: Affinity Purified
• Conjugation: Unconjugated

Storage & Handling

• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Buffer/Preservatives: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Concentration: 0.5 mg/ml
• Expiration Date: 12 months from date of receipt.
• Disclaimer: For research use only

Alternative Names

FLJ20312, MGC99541

Sample Tissue: Human OVCAR-3 Whole Cell, Antibody dilution: 3 ug/ml.

Positive control (+): 293T cell lysate (2T), Negative control (-): A549 cell lysate (N03), Antibody concentration: 3 ug/ml.

WB Suggested Anti-PNRC2 Antibody Titration: 0.2-1 ug/ml, ELISA Titer: 1:1562500, Positive Control: Hela cell lysate.

Quick Database Links

Gene Symbol

PNRC2

UniProt

Q9NPJ4

RefSeq (Protein):NP_060231