PNPLA2 Rabbit Polyclonal Antibody

• Catalog Number: orb584172
• Category: Antibodies
• Description: Rabbit polyclonal antibody to PNPLA2
• Target: PNPLA2
• Clonality: Polyclonal
• Species/Host: Rabbit
• Conjugation: Unconjugated
• Reactivity: Human
• Predicted Reactivity: Human
• Form/Appearance: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Concentration: 0.5 mg/ml
• Buffer/Preservatives: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Purification: Affinity Purified
• Protein Sequence: Synthetic peptide located within the following region: RDGLRFLQRNGLLNRPNPLLALPPARPHGPEDKDQAVESAQAEDYSQLPG
• UniProt ID: Q96AD5
• MW: 55kDa
• Tested applications: IHC, WB
• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Alternative names: ATGL, TTS2, PEDF-R, FP17548, TTS-2.2, iPLA2zeta, 1
• Research Area: Epigenetics
• Note: For research use only
• NCBI: NP_065109

Sample Type: MCF7 cell lysate. s, Antibody dilution: 1.0 ug/ml.

Rabbit Anti-PNPLA2 Antibody, Catalog Number: orb584172, Formalin Fixed Paraffin Embedded Tissue: Human heart Tissue, Observed Staining: Plasma membrane, Primary Antibody Concentration: 1:100, Other Working Concentrations: N/A, Secondary Antibody: Donkey anti-Rabbit-Cy3, Secondary Antibody Concentration: 1:200, Magnification: 20X, Exposure Time: 0.5-2.0 sec.