Queen's Award Received in 2021 ISO 9001 Certified Delivered over 1,000,000 bio-reagents to life science researchers Trusted by Life Science Communities
Cart summary

You have no items in your shopping cart.

PLXNA4 Rabbit Polyclonal Antibody

SKU: orb330980

Description

PLXNA4 Rabbit Polyclonal Antibody is an unconjugated, affinity purified antibody for the detection of PLXNA4. It is suitable for WB application. The immunogen is a synthetic peptide directed towards the middle region of human PLXNA4. This antibody reacts with Human samples and is predicted to react with Yeast. It is supplied as a liquid in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Research Area

Signal Transduction

Images & Validation

Tested ApplicationsWB
ReactivityHuman
Predicted ReactivityYeast

Related Conjugates & Formulations

Key Properties

HostRabbit
ClonalityPolyclonal
ImmunogenThe immunogen is a synthetic peptide directed towards the middle region of human PLXNA4
TargetPLXNA4
Protein SequenceSynthetic peptide located within the following region: TQEWIGVEGDPPGANIASQEQMLCVYLQCSSHKAISDQRVQPLLCCFLNV
Molecular Weight57kDa
PurificationAffinity Purified
ConjugationUnconjugated

Storage & Handling

StorageMaintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
Buffer/PreservativesLiquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Concentration0.5 mg/ml
Expiration Date12 months from date of receipt.
DisclaimerFor research use only

Alternative Names

anti DKFZp434G0625 antibody, anti DKFZp434G0625PRO34003 antibody, anti DKFZp566O0546 antibody, anti FAYV2820 antibody, anti FLJ35026 antibody, anti FLJ38287 antibody, anti KIAA1550 antibody, anti PLEXA4 antibody, anti PLXNA4A antibody, anti PLXNA4B antibody, anti PRO34003 antibody

Similar Products

  • Plexin A4 Rabbit Polyclonal Antibody (HRP) [orb470255]

    ELISA,  IHC-Fr,  IHC-P,  WB

    Bovine, Canine, Equine, Gallus, Human, Mouse, Rat, Sheep

    Rabbit

    Polyclonal

    HRP

    100 μl
  • Plexin A4 Rabbit Polyclonal Antibody (Cy5) [orb917245]

    ICC,  IF

    Bovine, Canine, Equine, Gallus, Human, Mouse, Rat, Sheep

    Rabbit

    Polyclonal

    Cy5

    100 μl
  • Plexin A4 Rabbit Polyclonal Antibody (PE-Cy5.5) [orb919045]

    ICC,  IF

    Bovine, Canine, Equine, Gallus, Human, Mouse, Rat, Sheep

    Rabbit

    Polyclonal

    PE/Cy5.5

    100 μl
  • Plexin A4 Rabbit Polyclonal Antibody (PE-Cy7) [orb919075]

    ICC,  IF

    Bovine, Canine, Equine, Gallus, Human, Mouse, Rat, Sheep

    Rabbit

    Polyclonal

    PE/Cy7

    100 μl
  • Plexin A4 Rabbit Polyclonal Antibody (APC) [orb995735]

    ICC,  IF

    Bovine, Canine, Equine, Gallus, Human, Mouse, Rat, Sheep

    Rabbit

    Polyclonal

    APC

    100 μl
Quality Guarantee

Quality Guarantee

Explore bioreagents carefree to elevate your research. All our products are rigorously tested for performance. If a product does not perform as described on its datasheet, our scientific support team will provide expert troubleshooting, a prompt replacement, or a refund. For full details, please see our Terms & Conditions and Buying Guide. Contact us at [email protected].

PLXNA4 Rabbit Polyclonal Antibody

WB Suggested Anti-PLXNA4 Antibody Titration: 0.2-1 ug/ml, ELISA Titer: 1:1562500, Positive Control: HepG2 cell lysate.

UniProt Details

No UniProt data available

NCBI Reference Sequences

Associated Accession Numbers
Curated reference sequences for the gene transcript and protein product
ProteinNP_861440

Documents Download

Datasheet
Product Information
Download

Request a Document

Protocol Information

WB
Western Blot (IB, immunoblot)
View Protocol

PLXNA4 Rabbit Polyclonal Antibody (orb330980)

  • Star
  • Star
  • Star
  • Star
  • Star
  • 0.0
Based on 0 reviews

Participating in our Biorbyt product reviews program enables you to support fellow scientists by sharing your firsthand experience with our products.

Login to Submit a Review

No reviews yet

Available Sizes

Select a size below

100 μl
$ 620.00
Free Secondary Antibody (20 ul)0/0

Please add an antibody product to your cart first.

DispatchUsually dispatched within 1 - 2 weeks
Bulk Enquiry