PLS3 Rabbit Polyclonal Antibody

SKU: orb583236

Description

Rabbit polyclonal antibody to PLS3

Research Area

Molecular Biology, Protein Biochemistry

Images & Validation

• Tested Applications: WB
• Reactivity: Human
• Predicted Reactivity: Bovine, Canine, Equine, Guinea pig, Mouse, Porcine, Rabbit, Rat, Yeast

Key Properties

• Host: Rabbit
• Clonality: Polyclonal
• Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human PLS3
• Target: PLS3
• Protein Sequence: Synthetic peptide located within the following region: RRYTLNVLEDLGDGQKANDDIIVNWVNRTLSEAGKSTSIQSFKDKTISSS
• Molecular Weight: 71 kDa
• Purification: Affinity Purified
• Conjugation: Unconjugated

Storage & Handling

• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Buffer/Preservatives: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Concentration: 0.5 mg/ml
• Expiration Date: 12 months from date of receipt.
• Disclaimer: For research use only

Alternative Names

BMND18, T-plastin

25 ug of the indicated whole cell extracts was loaded onto a 12% SDS-PAGE gel. 3 ug/ml of the antibody was used in this experiment. Recommended dilution for antibody is 1-3 ug/ml. Multiple isoforms of this protein are known and several share the peptide sequence.

WB Suggested Anti-PLS3 Antibody Titration: 0.2-1 ug/ml, ELISA Titer: 1:62500, Positive Control: HT1080 cell lysate. PLS3 is supported by BioGPS gene expression data to be expressed in HT1080.

Quick Database Links

Gene Symbol

PLS3

UniProt

P13797

RefSeq (Protein):NP_005023