PLPP1 Rabbit Polyclonal Antibody

• Catalog Number: orb578355
• Category: Antibodies
• Description: Rabbit polyclonal antibody to PLPP1
• Target: PLPP1
• Clonality: Polyclonal
• Species/Host: Rabbit
• Conjugation: Unconjugated
• Reactivity: Human, Mouse
• Predicted Reactivity: Bovine, Canine, Equine, Guinea pig, Rabbit, Rat, Zebrafish
• Form/Appearance: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Concentration: 1.0 mg/ml
• Buffer/Preservatives: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Purification: Protein A purified
• Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human PPAP2A
• Protein Sequence: Synthetic peptide located within the following region: DPDWSKINCSDGYIEYYICRGNAERVKEGRLSFYSGHSSFSMYCMLFVAL
• UniProt ID: O14494
• MW: 31kDa
• Tested applications: IHC, WB
• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Alternative names: LPP1, PAP2, LLP1a, PAP-2a, PPAP2A
• Research Area: Cell Biology, Disease Biomarkers, Immunology & Inf
• Note: For research use only
• NCBI: NP_795714

Sample Type: Mouse primary tissue, focusing in pLN, Primary Dilution: 1 mg/mL, Secondary Dilution: 125 ug/ml.

WB Suggested Anti-PPAP2A Antibody Titration: 2.5 ug/ml, Positive Control: Jurkat cell lysate.