PLP2 Rabbit Polyclonal Antibody

• Catalog Number: orb579441
• Category: Antibodies
• Description: Rabbit polyclonal antibody to PLP2
• Target: PLP2
• Clonality: Polyclonal
• Species/Host: Rabbit
• Conjugation: Unconjugated
• Reactivity: Human
• Predicted Reactivity: Bovine, Canine, Equine, Guinea pig, Mouse, Porcine, Rabbit, Rat, Sheep
• Form/Appearance: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Concentration: 1.0 mg/ml
• Buffer/Preservatives: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Purification: Protein A purified
• Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human PLP2
• Protein Sequence: Synthetic peptide located within the following region: LVERGNHSKIVAGVLGLIATCLFGYDAYVTFPVRQPRHTAAPTDPADGPV
• UniProt ID: Q04941
• MW: 17kDa
• Tested applications: WB
• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Alternative names: A4, A4LSB
• Research Area: Cell Biology, Signal Transduction
• Note: For research use only
• NCBI: NP_002659

WB Suggested Anti-PLP2 Antibody Titration: 1.25 ug/ml, Positive Control: HepG2 cell lysate.