You have no items in your shopping cart.
PLK2 Rabbit Polyclonal Antibody
Description
Research Area
Images & Validation
−| Tested Applications | IHC, WB |
|---|---|
| Reactivity | Human, Rat |
| Predicted Reactivity | Bovine, Canine, Equine, Guinea pig, Mouse, Rabbit, Zebrafish |
Key Properties
−| Host | Rabbit |
|---|---|
| Clonality | Polyclonal |
| Target | PLK2 |
| Protein Sequence | Synthetic peptide located within the following region: SDIWALGCVMYTMLLGRPPFETTNLKETYRCIREARYTMPSSLLAPAKHL |
| Molecular Weight | 78kDa |
| Purification | Affinity Purified |
| Conjugation | Unconjugated |
Storage & Handling
−| Storage | Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles. |
|---|---|
| Buffer/Preservatives | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Concentration | 0.5 mg/ml |
| Expiration Date | 12 months from date of receipt. |
| Disclaimer | For research use only |
Alternative Names
−Similar Products
−PLK2 Rabbit Polyclonal Antibody [orb312799]
IF, IHC-Fr, IHC-P, WB
Bovine, Canine, Equine, Porcine, Rat, Sheep, Zebrafish
Human, Mouse
Rabbit
Polyclonal
Unconjugated
50 μl, 100 μl, 200 μlPLK2 Rabbit Polyclonal Antibody [orb630012]
ELISA, IP, WB
Human, Mouse, Rat
Rabbit
Polyclonal
Unconjugated
50 μg, 100 μg

Quality Guarantee
Explore bioreagents carefree to elevate your research. All our products are rigorously tested for performance. If a product does not perform as described on its datasheet, our scientific support team will provide expert troubleshooting, a prompt replacement, or a refund. For full details, please see our Terms & Conditions and Buying Guide. Contact us at [email protected].

Sample Tissue: Rat Skeletal Muscle, Antibody dilution: 1 ug/ml.

Sample Tissue: Rat Skeletal Muscle, Antibody dilution: 1 ug/ml.

Rabbit Anti-PLK2 Antibody, Catalog Number: orb581615, Formalin Fixed Paraffin Embedded Tissue: Human heart Tissue, Observed Staining: Cytoplasmic in endothelial cells in blood vessels, Primary Antibody Concentration: N/A, Other Working Concentrations: 1:600, Secondary Antibody: Donkey anti-Rabbit-Cy3, Secondary Antibody Concentration: 1:200, Magnification: 20X, Exposure Time: 0.5-2.0 sec.

WB Suggested Anti-PLK2 Antibody, Titration: 1.0 ug/ml, Positive Control: Jurkat Whole Cell.
Documents Download
Request a Document
Protocol Information
PLK2 Rabbit Polyclonal Antibody (orb581615)
Participating in our Biorbyt product reviews program enables you to support fellow scientists by sharing your firsthand experience with our products.
Login to Submit a Review








