PLG Rabbit Polyclonal Antibody

SKU: orb325672

Description

PLG Rabbit Polyclonal Antibody is an unconjugated, affinity purified antibody for the detection of PLG. It is suitable for WB application. The immunogen is a synthetic peptide directed towards the middle region of Human PLMN. This antibody reacts with Human samples and is predicted to react with Bovine, Canine, Equine, Goat, Mouse, Porcine, Rabbit, Rat. It is supplied as a liquid in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Research Area

Cardiovascular Research

Images & Validation

• Tested Applications: WB
• Reactivity: Human
• Predicted Reactivity: Bovine, Canine, Equine, Goat, Mouse, Porcine, Rabbit, Rat

Key Properties

• Host: Rabbit
• Clonality: Polyclonal
• Immunogen: The immunogen is a synthetic peptide directed towards the middle region of Human PLMN
• Target: PLG
• Protein Sequence: Synthetic peptide located within the following region: TAPPELTPVVQDCYHGDGQSYRGTSSTTTTGKKCQSWSSMTPHRHQKTPE
• Molecular Weight: 89kDa
• Purification: Affinity purified
• Conjugation: Unconjugated

Storage & Handling

• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Buffer/Preservatives: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Concentration: 0.5 mg/ml
• Expiration Date: 12 months from date of receipt.
• Disclaimer: For research use only

Alternative Names

anti-Angiostatin antibody, anti-Plasmin antibody, anti-Plasmin heavy chain A antibody, anti-Plasmin light chain B antibody, anti-PLG antibody

Sample Type: Jurkat Whole Cell lysates, Antibody Dilution: 1.0 ug/mL.

Quick Database Links

Gene Symbol

PLG

UniProt

P00747

RefSeq (Protein):NP_000292