You have no items in your shopping cart.
Cart summary
Item 1 of 1
PLEKHO1 Rabbit Polyclonal Antibody
Catalog Number: orb330520
| Catalog Number | orb330520 |
|---|---|
| Category | Antibodies |
| Description | Rabbit polyclonal antibody to PLEKHO1 |
| Target | PLEKHO1 |
| Clonality | Polyclonal |
| Species/Host | Rabbit |
| Conjugation | Unconjugated |
| Reactivity | Human |
| Predicted Reactivity | Bovine, Porcine, Rat |
| Form/Appearance | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Concentration | 0.5 mg/ml |
| Buffer/Preservatives | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Immunogen | The immunogen is a synthetic peptide directed towards the N terminal region of human PLEKHO1 |
| Protein Sequence | Synthetic peptide located within the following region: MMKKNNSAKRGPQDGNQQPAPPEKVGWVRKFCGKGIFREIWKNRYVVLKG |
| UniProt ID | Q53GL0 |
| MW | 46kDa |
| Tested applications | WB |
| Storage | Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles. |
| Alternative names | anti CKIP-1 antibody, anti OC120 antibody, anti RP Read more... |
| Note | For research use only |
| NCBI | NP_057358 |
WB Suggested Anti-PLEKHO1 Antibody Titration: 0.2-1 ug/ml, ELISA Titer: 1:62500, Positive Control: COLO205 cell lysate.
- Item 1 of 7
PLEKHO1 Rabbit Polyclonal Antibody [orb10417]
IF, IHC-Fr, IHC-P, WB
Mouse, Rat
Human, Mouse, Rat
Rabbit
Polyclonal
Unconjugated
50 μl, 100 μl, 200 μl - Item 1 of 3
- Item 1 of 3
- Item 1 of 1
PLEKHO1 Rabbit Polyclonal Antibody (HRP) [orb2115113]
WB
Bovine, Human, Porcine, Rat
Rabbit
Polyclonal
HRP
100 μl
