PLCG2 Rabbit Polyclonal Antibody

SKU: orb587945

Description

Rabbit polyclonal antibody to PLCG2

Research Area

Cell Biology, Immunology & Inflammation, Signal Transduction

Images & Validation

• Tested Applications: WB
• Reactivity: Human, Mouse
• Predicted Reactivity: Bovine, Canine, Equine, Guinea pig, Rabbit, Rat

Key Properties

• Host: Rabbit
• Clonality: Polyclonal
• Immunogen: The immunogen is a synthetic peptide directed towards the middle region of Human PLCG2
• Target: PLCG2
• Protein Sequence: Synthetic peptide located within the following region: ETHLRCAEFELRLTDPVPNPNPHESKPWYYDSLSRGEAEDMLMRIPRDGA
• Molecular Weight: 139kDa
• Purification: Affinity Purified
• Conjugation: Unconjugated

Storage & Handling

• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Buffer/Preservatives: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Concentration: 0.5 mg/ml
• Expiration Date: 12 months from date of receipt.
• Disclaimer: For research use only

Alternative Names

FCAS3, APLAID, PLC-IV, PLC-gamma-2

Sample Tissue: Mouse Liver, Antibody Dilution: 1 ug/ml.

Sample Tissue: Human Fetal Liver, Antibody Dilution: 1 ug/ml.

Sample Tissue: Mouse Liver, Antibody Dilution: 1 ug/ml.

Quick Database Links

Gene Symbol

PLCG2

UniProt

P16885

RefSeq (Protein):NP_002652