PLCG1 Rabbit Polyclonal Antibody

SKU: orb574505

Description

Rabbit polyclonal antibody to PLCG1

Research Area

Cell Biology, Signal Transduction

Images & Validation

• Tested Applications: WB
• Reactivity: Human
• Predicted Reactivity: Bovine, Canine, Equine, Guinea pig, Mouse, Rabbit, Rat

Key Properties

• Host: Rabbit
• Clonality: Polyclonal
• Immunogen: The immunogen is a synthetic peptide directed towards the C-terminal region of Human PLCG1
• Target: PLCG1
• Protein Sequence: Synthetic peptide located within the following region: RGIVCPFVEIEVAGAEYDSTKQKTEFVVDNGLNPVWPAKPFHFQISNPEF
• Molecular Weight: 141 kDa
• Purification: Affinity purified
• Conjugation: Unconjugated

Storage & Handling

• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Buffer/Preservatives: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Concentration: 0.5 mg/ml
• Expiration Date: 12 months from date of receipt.
• Disclaimer: For research use only

Alternative Names

PLC1, NCKAP3, PLC-II, PLC148, PLCgamma1

Sample Type: PANC1 Whole Cell, Antibody dilution: 1.0 ug/ml.

Rabbit Anti-PLCG1 Antibody, Catalog Number: orb574505, Formalin Fixed Paraffin Embedded Tissue: Human Lymph Node Tissue, Observed Staining: Plasma membrane, Cytoplasm, Primary Antibody Concentration: 1:100, Other Working Concentrations: N/A, Secondary Antibody: Donkey anti-Rabbit-Cy3, Secondary Antibody Concentration: 1:200, Magnification: 20X, Exposure Time: 0.5-2.0 sec.

Quick Database Links

Gene Symbol

PLCG1

UniProt

P19174