PLCB1 Rabbit Polyclonal Antibody

• Catalog Number: orb582913
• Category: Antibodies
• Description: Rabbit polyclonal antibody to PLCB1
• Species/Host: Rabbit
• Clonality: Polyclonal
• Tested applications: WB
• Predicted Reactivity: Bovine, Canine, Equine, Guinea pig, Rabbit, Rat
• Reactivity: Human, Mouse
• Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human PLCB1
• Concentration: 0.5 mg/ml
• Form/Appearance: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Conjugation: Unconjugated
• MW: 134kDa
• Target: PLCB1
• UniProt ID: D3DW13
• Protein Sequence: Synthetic peptide located within the following region: EAQSKRQEKLVEKHKEIRQQILDEKPKGEGSSSFLSETCHEDPSVSPNFT
• NCBI: NP_877398
• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Buffer/Preservatives: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Alternative names: DEE12, PLC-I, EIEE12, PI-PLC, PLC154, PLCB1A, PLCB
• Note: For research use only
• Expiration Date: 12 months from date of receipt.

Sample Tissue: Mouse Brain, Antibody dilution: 1 ug/ml.

WB Suggested Anti-PLCB1 Antibody Titration: 0.2-1 ug/ml, ELISA Titer: 1:312500, Positive Control: HepG2 cell lysate. There is BioGPS gene expression data showing that PLCB1 is expressed in HepG2.