You have no items in your shopping cart.
You have no items in your shopping cart.
Catalog Number | orb2290785 |
---|---|
Category | Antibodies |
Description | Mouse monoclonal antibody raised against a partial recombinant PLA2G12A. |
Clonality | Monoclonal |
Species/Host | Mouse |
Isotype | IgG1 Kappa |
Conjugation | Unconjugated |
Reactivity | Human |
Buffer/Preservatives | In 1x PBS, pH 7.4 |
Immunogen | PLA2G12A (NP_110448, 90 a.a. ~ 188 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
Protein Sequence | PLFGVHLNIGIPSLTKCCNQHDRCYETCGKSKNDCDEEFQYCLSKICRDVQKTLGLTQHVQACETTVELLFDSVIHLGCKPYLDSQRAACRCHYEEKTD |
Tested applications | ELISA, WB |
Clone Number | 1D11 |
Storage | Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles. |
Note | For research use only |
NCBI | NP_110448 |
Detection limit for recombinant GST tagged PLA2G12A is approximately 0.3 ng/ml as a capture antibody.
Western Blot analysis of PLA2G12A expression in transfected 293T cell line by PLA2G12A monoclonal antibody (M01), clone 1D11. Lane 1: PLA2G12A transfected lysate(21.1 KDa). Lane 2: Non-transfected lysate.
Western Blot detection against Immunogen (36.63 KDa).