PLA2G12A monoclonal antibody (M01), clone 1D11

• Catalog Number: orb2290785
• Category: Antibodies
• Description: Mouse monoclonal antibody raised against a partial recombinant PLA2G12A.
• Clonality: Monoclonal
• Species/Host: Mouse
• Isotype: IgG1 Kappa
• Conjugation: Unconjugated
• Reactivity: Human
• Buffer/Preservatives: In 1x PBS, pH 7.4
• Immunogen: PLA2G12A (NP_110448, 90 a.a. ~ 188 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
• Protein Sequence: PLFGVHLNIGIPSLTKCCNQHDRCYETCGKSKNDCDEEFQYCLSKICRDVQKTLGLTQHVQACETTVELLFDSVIHLGCKPYLDSQRAACRCHYEEKTD
• Tested applications: ELISA, WB
• Clone Number: 1D11
• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Note: For research use only
• NCBI: NP_110448

Detection limit for recombinant GST tagged PLA2G12A is approximately 0.3 ng/ml as a capture antibody.

Western Blot analysis of PLA2G12A expression in transfected 293T cell line by PLA2G12A monoclonal antibody (M01), clone 1D11. Lane 1: PLA2G12A transfected lysate(21.1 KDa). Lane 2: Non-transfected lysate.

Western Blot detection against Immunogen (36.63 KDa).