You have no items in your shopping cart.
You have no items in your shopping cart.
Catalog Number | orb2291787 |
---|---|
Category | Antibodies |
Description | Mouse monoclonal antibody raised against a partial recombinant PKD2L1. |
Clonality | Monoclonal |
Species/Host | Mouse |
Isotype | IgG2b Kappa |
Conjugation | Unconjugated |
Reactivity | Human, Rat |
Buffer/Preservatives | In 1x PBS, pH 7.4 |
Immunogen | PKD2L1 (NP_057196.2, 173 a.a. ~ 272 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
Protein Sequence | KWYNNQSLGHGSHSFIYYENMLLGVPRLRQLKVRNDSCVVHEDFREDILSCYDVYSPDKEEQLPFGPFNGTAWTYHSQDELGGFSHWGRLTSYSGGGYYL |
Tested applications | ELISA, WB |
Clone Number | 4F9 |
Storage | Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles. |
Note | For research use only |
NCBI | NP_057196.2 |
PKD2L1 monoclonal antibody (M01), clone 4F9. Western Blot analysis of PKD2L1 expression in rat brain.
Western Blot detection against Immunogen (36.74 KDa).