PKD2L1 monoclonal antibody (M01), clone 4F9

• Catalog Number: orb2291787
• Category: Antibodies
• Description: Mouse monoclonal antibody raised against a partial recombinant PKD2L1.
• Species/Host: Mouse
• Clonality: Monoclonal
• Clone Number: 4F9
• Tested applications: ELISA, WB
• Reactivity: Human, Rat
• Isotype: IgG2b Kappa
• Immunogen: PKD2L1 (NP_057196.2, 173 a.a. ~ 272 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
• Conjugation: Unconjugated
• Protein Sequence: KWYNNQSLGHGSHSFIYYENMLLGVPRLRQLKVRNDSCVVHEDFREDILSCYDVYSPDKEEQLPFGPFNGTAWTYHSQDELGGFSHWGRLTSYSGGGYYL
• NCBI: NP_057196.2
• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Buffer/Preservatives: In 1x PBS, pH 7.4
• Note: For research use only
• Expiration Date: 12 months from date of receipt.

PKD2L1 monoclonal antibody (M01), clone 4F9. Western Blot analysis of PKD2L1 expression in rat brain.

Western Blot detection against Immunogen (36.74 KDa).