PIN4 Rabbit Polyclonal Antibody

SKU: orb583264

Description

Rabbit polyclonal antibody to PIN4

Research Area

Cell Biology, Epigenetics & Chromatin

Images & Validation

• Tested Applications: WB
• Reactivity: Human
• Predicted Reactivity: Rat

Key Properties

• Host: Rabbit
• Clonality: Polyclonal
• Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human PIN4
• Target: PIN4
• Protein Sequence: Synthetic peptide located within the following region: MPMAGLLKGLVRQLERFSVQQQASKMPPKGKSGSGKAGKGGAASGSDSAD
• Molecular Weight: 16kDa
• Purification: Affinity Purified
• Conjugation: Unconjugated

Storage & Handling

• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Buffer/Preservatives: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Concentration: 0.5 mg/ml
• Expiration Date: 12 months from date of receipt.
• Disclaimer: For research use only

Alternative Names

EPVH, PAR14, PAR17

WB Suggested Anti-PIN4 Antibody Titration: 0.2-1 ug/ml, ELISA Titer: 1:12500, Positive Control: 293T cell lysate. PIN4 is strongly supported by BioGPS gene expression data to be expressed in Human HEK293T cells.

Quick Database Links

Gene Symbol

PIN4

UniProt

Q9Y237

RefSeq (Protein):NP_006214