Availability

  • Request Lead Time
  • In stock and ready for quick dispatch
  • Usually dispatched within 1 to 3 weeks
Shipping Destination:
United States
Shipping charges:
Freight/Packing: $34.00

Need Help?

Ask a Question Support@biorbyt.com
Product Overview
Product Name Pig IL33 protein
Catalog Number orb244304
Species/HostPorcine
ConjugationUnconjugated
Target IL33
Alternative Names
Product Properties
Form/Appearance Tris-based buffer, 50% glycerol
Storage Store at -20°C. for extended storage, conserve at -20°C or -80°C.
Note For research use only.
Protein Sequence EHSASLSTYNDQYITFAFEDGSYEIYVEDLRKDQEKDKVLLRYYDSQIPSSETDGGGDHRKLMVNLSPTKDKDFLLHANSKEHSVELQKCENPLPEQAFFVLHEQPSKCVSFECKSHPGVFLGVKNNQLALIKLGEHPEDSNRENTTFKLSNLM
Purity >90% as determined by SDS-PAGE.
MW 45 kDa
Source E. coli
Uniprot ID M5B263
Product Description

Recombinant Sus scrofa (pig) Interleukin-33

Application Notes
Application Notes Expression region is 129-282aa and GST-tag protein
Reviews
Write Your Own Review
You're reviewing:Pig IL33 protein - orb244304
Your Rating