PICK1 Antibody

• Catalog Number: orb2236550
• Category: Antibodies
• Description: PICK1 Antibody
• Species/Host: Mouse
• Clonality: Monoclonal
• Clone Number: 3G5
• Tested applications: ELISA, WB
• Isotype: IgG2a Kappa
• Immunogen: PRKCABP (NP_036539, 266 a.a. ~ 375 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
• Form/Appearance: Liquid
• Conjugation: Unconjugated
• Protein Sequence: KVKEMDDEEYSCIALGEPLYRVSTGNYEYRLILRCRQEARARFSQMRKDVLEKMELLDQKHVQDIVFQLQRLVSTMSKYYNDCYAVLRDADVFPIEVDLAHTTLAYGLNQ
• NCBI: NP_036539
• Storage: Store at -2°C or lower. Aliquot to avoid repeated freezing and thawing.
• Buffer/Preservatives: Liquid
• Alternative names: PICK;PRKCA-binding protein;PRKCABP;protein interac
• Note: For research use only
• Expiration Date: 12 months from date of receipt.