Queen's Award Received in 2021 ISO 9001 Certified Delivered over 1,000,000 bio-reagents to life science researchers Trusted by Life Science Communities
Cart summary

You have no items in your shopping cart.

PI3 Rabbit Polyclonal Antibody

SKU: orb325211

Description

PI3 Rabbit Polyclonal Antibody is an unconjugated, affinity purified antibody for the detection of PI3. It is suitable for WB application. The immunogen is a synthetic peptide directed towards the middle region of human PI3. This antibody reacts with Human samples and is predicted to react with Bovine, Porcine, Sheep. It is supplied as a liquid in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Research Area

Cell Biology, Signal Transduction

Images & Validation

Tested ApplicationsWB
ReactivityHuman
Predicted ReactivityBovine, Porcine, Sheep

Related Conjugates & Formulations

Key Properties

HostRabbit
ClonalityPolyclonal
ImmunogenThe immunogen is a synthetic peptide directed towards the middle region of human PI3
TargetPI3
Protein SequenceSynthetic peptide located within the following region: KGRVPFNGQDPVKGQVSVKGQDKVKAQEPVKGPVSTKPGSCPIILIRCAM
Molecular Weight6kDa
PurificationAffinity Purified
ConjugationUnconjugated

Storage & Handling

StorageMaintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
Buffer/PreservativesLiquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Concentration0.5 mg/ml
Expiration Date12 months from date of receipt.
DisclaimerFor research use only

Alternative Names

anti ESI antibody, anti MGC13613 antibody, anti SKALP antibody, anti WAP3 antibody, anti WFDC14 antibody, anti cementoin antibody

Similar Products

  • Phospho-PI3 Kinase p110 beta (Ser1070) Rabbit Polyclonal Antibody [orb2298]

    ICC,  IF,  IHC-Fr,  IHC-P,  WB

    Bovine, Canine, Equine, Gallus, Guinea pig, Porcine

    Human, Mouse, Rat

    Rabbit

    Polyclonal

    Unconjugated

    50 μl, 100 μl, 200 μl
  • PI 3 Kinase Class 3 Rabbit Polyclonal Antibody [orb6702]

    IF,  IHC-Fr,  IHC-P,  WB

    Bovine, Canine, Equine, Gallus, Porcine, Rabbit

    Human, Mouse, Rat

    Rabbit

    Polyclonal

    Unconjugated

    50 μl, 100 μl, 200 μl
  • PIK3R1 Rabbit Polyclonal Antibody [orb11271]

    IF,  IHC-Fr,  IHC-P

    Bovine, Canine, Equine, Porcine, Rabbit, Sheep

    Human, Mouse, Rat

    Rabbit

    Polyclonal

    Unconjugated

    50 μl, 100 μl, 200 μl
  • Phospho-PI3 kinase p85 alpha + gamma (Tyr467 + Tyr199) Rabbit Polyclonal Antibody [orb106105]

    FC,  IF,  IHC-Fr,  IHC-P

    Bovine, Canine, Equine, Mouse, Porcine, Rabbit

    Human, Rat

    Rabbit

    Polyclonal

    Unconjugated

    50 μl, 100 μl, 200 μl
  • PIK3CA Rabbit Polyclonal Antibody [orb11272]

    IF,  IHC-Fr,  IHC-P,  WB

    Bovine, Gallus, Rabbit

    Human, Mouse, Rat

    Rabbit

    Polyclonal

    Unconjugated

    50 μl, 100 μl, 200 μl
Quality Guarantee

Quality Guarantee

Explore bioreagents carefree to elevate your research. All our products are rigorously tested for performance. If a product does not perform as described on its datasheet, our scientific support team will provide expert troubleshooting, a prompt replacement, or a refund. For full details, please see our Terms & Conditions and Buying Guide. Contact us at [email protected].

UniProt Details

No UniProt data available

NCBI Reference Sequences

Associated Accession Numbers
Curated reference sequences for the gene transcript and protein product
ProteinNP_002629

Protocol Information

WB
Western Blot (IB, immunoblot)
View Protocol

Available Sizes

Select a size below

100 μl
$ 620.00
Free Secondary Antibody (20 ul)0/0

Please add an antibody product to your cart first.

DispatchUsually dispatched within 1 - 2 weeks
Bulk Enquiry