PHYHIP Rabbit Polyclonal Antibody

• Catalog Number: orb574862
• Category: Antibodies
• Description: Rabbit polyclonal antibody to PHYHIP
• Target: PHYHIP
• Clonality: Polyclonal
• Species/Host: Rabbit
• Conjugation: Unconjugated
• Reactivity: Human
• Predicted Reactivity: Bovine, Canine, Equine, Goat, Guinea pig, Mouse, Rabbit, Rat
• Form/Appearance: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Concentration: 1.0 mg/ml
• Buffer/Preservatives: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Purification: Protein A purified
• Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human PHYHIP
• Protein Sequence: Synthetic peptide located within the following region: VSGWSETVEFCTGDYAKEHLAQLQEKAEQIAGRMLRFSVFYRNHHKEYFQ
• UniProt ID: Q92561
• MW: 38kDa
• Tested applications: WB
• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Alternative names: PAHX-AP, PAHXAP1, DYRK1AP3
• Research Area: Stem Cell & Developmental Biology
• Note: For research use only
• NCBI: NP_055574

WB Suggested Anti-PHYHIP Antibody Titration: 1.25 ug/ml, Positive Control: Transfected 293T.