PHF6 Rabbit Polyclonal Antibody

• Catalog Number: orb581313
• Category: Antibodies
• Description: Rabbit polyclonal antibody to PHF6
• Species/Host: Rabbit
• Clonality: Polyclonal
• Tested applications: WB
• Predicted Reactivity: Bovine, Canine, Equine, Guinea pig, Mouse, Porcine, Rabbit, Rat
• Reactivity: Human
• Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human PHF6
• Concentration: 1.0 mg/ml
• Form/Appearance: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Conjugation: Unconjugated
• MW: 41kDa
• Target: PHF6
• UniProt ID: Q8IWS0
• Protein Sequence: Synthetic peptide located within the following region: VGQNHSEDGAPALLTTAPPPGLQPGAGGTPGGPGGGGAPPRYATLEHPFH
• NCBI: NP_115834
• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Buffer/Preservatives: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Alternative names: BFLS, BORJ, CENP-31
• Note: For research use only
• Expiration Date: 12 months from date of receipt.

Sample Type: HEK293T cells transfected with a plasmid for over expression of myc-tagged PHF6, Primary dilution: 1:1000, Secondary (goat anti-rabbit HRP) dilution: 1:1000.

WB Suggested Anti-PHF6 Antibody Titration: 5.0 ug/ml, Positive Control: Jurkat cell lysate.