PHF11 Rabbit Polyclonal Antibody

• Catalog Number: orb575288
• Category: Antibodies
• Description: Rabbit polyclonal antibody to PHF11
• Target: PHF11
• Clonality: Polyclonal
• Species/Host: Rabbit
• Conjugation: Unconjugated
• Reactivity: Human
• Predicted Reactivity: Canine
• Form/Appearance: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Concentration: 0.5 mg/ml
• Buffer/Preservatives: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Purification: Affinity Purified
• Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human PHF11
• Protein Sequence: Synthetic peptide located within the following region: FSGVKRKRGRKKPLSGNHVQPPETMKCNTFIRQVKEEHGRHTDATVKVPF
• UniProt ID: Q9UIL8
• MW: 37kDa
• Tested applications: IHC, WB
• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Alternative names: APY, BCAP, IGEL, IGER, IGHER, NYREN34, NY-REN-34
• Research Area: Epigenetics & Chromatin
• Note: For research use only
• NCBI: NP_001035533

Rabbit Anti-PHF11 antibody, Paraffin Embedded Tissue: Human Heart, cell Cellular Data: cardiac cell, Antibody Concentration: 4.0-8.0 ug/ml Magnification: 400X.

WB Suggested Anti-PHF11 Antibody Titration: 0.2-1 ug/ml, ELISA Titer: 1:62500, Positive Control: HepG2 cell lysate, PHF11 is supported by BioGPS gene expression data to be expressed in HepG2.