PHF1 Rabbit Polyclonal Antibody

• Catalog Number: orb574483
• Category: Antibodies
• Description: Rabbit polyclonal antibody to PHF1
• Species/Host: Rabbit
• Clonality: Polyclonal
• Tested applications: IHC, WB
• Predicted Reactivity: Bovine, Canine, Equine, Guinea pig, Mouse, Rabbit, Rat
• Reactivity: Human
• Immunogen: The immunogen is a synthetic peptide directed towards the C terminal region of human PHF1
• Concentration: 1.0 mg/ml
• Form/Appearance: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Conjugation: Unconjugated
• MW: 62kDa
• Target: PHF1
• UniProt ID: O43189
• Protein Sequence: Synthetic peptide located within the following region: PSPNQSYQGSSGYNFRPTDARCLPSSPIRMFASFHPSASTAGTSGDSGPP
• NCBI: NP_077084
• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Buffer/Preservatives: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Alternative names: PCL1, PHF2, hPHF1, MTF2L2, TDRD19C
• Note: For research use only
• Expiration Date: 12 months from date of receipt.

Human Stomach

WB Suggested Anti-PHF1 Antibody Titration: 1.25 ug/ml, Positive Control: 293T cell lysate.