You have no items in your shopping cart.
Cart summary
Item 1 of 1
PHC2 monoclonal antibody (M01), clone 1F4
Catalog Number: orb2293343
| Catalog Number | orb2293343 |
|---|---|
| Category | Antibodies |
| Description | Mouse monoclonal antibody raised against a partial recombinant PHC2. |
| Clonality | Monoclonal |
| Species/Host | Mouse |
| Isotype | IgG2a Kappa |
| Conjugation | Unconjugated |
| Reactivity | Human |
| Buffer/Preservatives | In 1x PBS, pH 7.4 |
| Immunogen | PHC2 (NP_004418.2, 91 a.a. ~ 200 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
| Protein Sequence | PYLQESKEEGAPLKLKCELCGRVDFAYKFKRSKRFCSMACAKRYNVGCTKRVGLFHSDRSKLQKAGAATHNRRRASKASLPPLTKDTKKQPTGTVPLSVTAALQLTHSQE |
| Tested applications | ELISA, WB |
| Clone Number | 1F4 |
| Storage | Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles. |
| Note | For research use only |
| NCBI | NP_004418.2 |
Western Blot analysis of PHC2 expression in transfected 293T cell line by PHC2 monoclonal antibody (M01), clone 1F4. Lane 1: PHC2 transfected lysate (Predicted MW: 35.8 KDa). Lane 2: Non-transfected lysate.
