PGS1 Rabbit Polyclonal Antibody

SKU: orb580567

Description

Rabbit polyclonal antibody to PGS1

Research Area

Stem Cell & Developmental Biology

Images & Validation

• Tested Applications: WB
• Reactivity: Human
• Predicted Reactivity: Bovine, Canine, Equine, Guinea pig, Mouse, Rabbit, Rat, Zebrafish

Key Properties

• Host: Rabbit
• Clonality: Polyclonal
• Immunogen: The immunogen is a synthetic peptide directed towards the C terminal region of human PGS1
• Target: PGS1
• Protein Sequence: Synthetic peptide located within the following region: RVQLQEYWRRGWTFHAKGLWLYLAGSSLPCLTLIGSPNFGYRSVHRDLEA
• Molecular Weight: 60kDa
• Purification: Protein A purified
• Conjugation: Unconjugated

Storage & Handling

• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Buffer/Preservatives: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Concentration: 1.0 mg/ml
• Expiration Date: 12 months from date of receipt.
• Disclaimer: For research use only

Alternative Names

DKFZP762M186, MGC131960

Positive control (+): HeLa Cell Lysate (HL), Negative control (-): THP1 Cell Lysate (N30), Antibody concentration: 1 ug/ml.

WB Suggested Anti-PGS1 Antibody Titration: 1.25 ug/ml, Positive Control: Jurkat cell lysate.

Quick Database Links

Gene Symbol

PGS1

UniProt

Q32NB8

RefSeq:AAH25951