PFN1 polyclonal antibody (A01)

• Catalog Number: orb2292420
• Category: Antibodies
• Description: Mouse polyclonal antibody raised against a full-length recombinant PFN1.
• Clonality: Polyclonal
• Species/Host: Mouse
• Conjugation: Unconjugated
• Reactivity: Human, Mouse
• Buffer/Preservatives: 50 % glycerol
• Immunogen: PFN1 (AAH06768, 1 a.a. ~ 140 a.a) full-length recombinant protein with GST tag.
• Protein Sequence: MAGWNAYIDNLMADGTCQDAAIVGYKDSPSVWAAVPGKTFVNITPAEVGVLVGKDRSSFYVNGLTLGGQKCSVIRDSLLQDGEFSMDLRTKSTGGAPTFNVTVTKTDKTLVLLMGKEGVHGGLINKKCYEMASHLRRSQY
• Tested applications: ELISA, WB
• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Note: For research use only
• NCBI: AAH06768

PFN1 polyclonal antibody (A01), Western Blot analysis of PFN1 expression in HeLa.

PFN1 polyclonal antibody (A01), Western Blot analysis of PFN1 expression in Raw 264.7.

Western Blot detection against Immunogen (41.51 KDa).