PDXP Rabbit Polyclonal Antibody

SKU: orb326200

Description

PDXP Rabbit Polyclonal Antibody is an unconjugated, affinity purified antibody for the detection of PDXP. It is suitable for WB application. The immunogen is a synthetic peptide directed towards the middle region of human PDXP. This antibody reacts with Human samples and is predicted to react with Bovine, Canine, Equine, Mouse, Rat. It is supplied as a liquid in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Research Area

Signal Transduction

Images & Validation

• Tested Applications: WB
• Reactivity: Human
• Predicted Reactivity: Bovine, Canine, Equine, Mouse, Rat

Key Properties

• Host: Rabbit
• Clonality: Polyclonal
• Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human PDXP
• Target: PDXP
• Protein Sequence: Synthetic peptide located within the following region: DPWHPLSDGSRTPGTGSLAAAVETASGRQALVVGKPSPYMFECITENFSI
• Molecular Weight: 32 kDa
• Purification: Affinity Purified
• Conjugation: Unconjugated

Storage & Handling

• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Buffer/Preservatives: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Concentration: 0.5 mg/ml
• Expiration Date: 12 months from date of receipt.
• Disclaimer: For research use only

Alternative Names

anti CIN antibody, anti FLJ32703 antibody, anti PLP antibody, anti dJ37E16.5 antibody

Quick Database Links

Gene Symbol

PDXP

UniProt

Q96GD0

RefSeq (Protein):NP_064711