PDIA6 Rabbit Polyclonal Antibody

• Catalog Number: orb581571
• Category: Antibodies
• Description: Rabbit polyclonal antibody to PDIA6
• Species/Host: Rabbit
• Clonality: Polyclonal
• Tested applications: IHC, WB
• Predicted Reactivity: Bovine, Canine, Equine, Guinea pig, Mouse, Porcine, Rabbit, Rat
• Reactivity: Human
• Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human PDIA6
• Concentration: 0.5 mg/ml
• Form/Appearance: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Conjugation: Unconjugated
• MW: 48kDa
• Target: PDIA6
• UniProt ID: Q15084
• Protein Sequence: Synthetic peptide located within the following region: KLAAVDATVNQVLASRYGIRGFPTIKIFQKGESPVDYDGGRTRSDIVSRA
• NCBI: NP_005733
• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Buffer/Preservatives: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Alternative names: P5, ERP5, TXNDC7
• Note: For research use only
• Expiration Date: 12 months from date of receipt.

Sample Type: 721_B, Antibody dilution: 1.0 ug/ml. PDIA6 is strongly supported by BioGPS gene expression data to be expressed in Human 721_B cells.

Sample Type: Human Adult Placenta, Antibody dilution: 1.0 ug/ml.

Sample Type: Human Fetal Liver, Antibody dilution: 1.0 ug/ml.

Sample Type: Human Fetal Lung, Antibody dilution: 1.0 ug/ml.

Sample Type: MCF7, Antibody dilution: 1.0 ug/ml. PDIA6 is strongly supported by BioGPS gene expression data to be expressed in MCF7.

Immunohistochemistry with Small intestine tissue.

WB Suggested Anti-PDIA6 Antibody Titration: 0.2-1 ug/ml, ELISA Titer: 1:1562500, Positive Control: HepG2 cell lysate. PDIA6 is strongly supported by BioGPS gene expression data to be expressed in HepG2.