Pdgfc Rabbit Polyclonal Antibody

SKU: orb585118

Description

Pdgfc Rabbit Polyclonal Antibody is an unconjugated, affinity purified antibody for the detection of Pdgfc. It is suitable for WB application. The immunogen is a synthetic peptide directed towards the N-terminal region of Mouse Pdgfc. This antibody reacts with Mouse samples and is predicted to react with Equine, Human, Rabbit, Rat. It is supplied as a liquid in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Research Area

Stem Cell & Developmental Biology

Images & Validation

• Tested Applications: WB
• Reactivity: Mouse
• Predicted Reactivity: Equine, Human, Rabbit, Rat

Key Properties

• Host: Rabbit
• Clonality: Polyclonal
• Immunogen: The immunogen is a synthetic peptide directed towards the N-terminal region of Mouse Pdgfc
• Target: Pdgfc
• Protein Sequence: Synthetic peptide located within the following region: MLLLGLLLLTSALAGQRTGTRAESNLSSKLQLSSDKEQNGVQDPRHERVV
• Molecular Weight: 39kDa
• Purification: Affinity Purified
• Conjugation: Unconjugated

Storage & Handling

• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Buffer/Preservatives: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Concentration: 0.5 mg/ml
• Expiration Date: 12 months from date of receipt.
• Disclaimer: For research use only

Alternative Names

PDGF-, SCDGF, PDGF-C, VEGF-E, AI647969, 1110064L01Rik

Quick Database Links

Gene Symbol

Pdgfc

UniProt

Q8CI19

RefSeq (Protein):NP_064355