PDE4D Rabbit Polyclonal Antibody

• Catalog Number: orb583258
• Category: Antibodies
• Description: Rabbit polyclonal antibody to PDE4D
• Species/Host: Rabbit
• Clonality: Polyclonal
• Tested applications: WB
• Predicted Reactivity: Bovine, Canine, Equine, Guinea pig, Rabbit, Rat, Zebrafish
• Reactivity: Human, Mouse
• Immunogen: The immunogen is a synthetic peptide directed towards the C-terminal region of Human PDE4D
• Concentration: 0.5 mg/ml
• Form/Appearance: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Conjugation: Unconjugated
• MW: 55kDa
• Target: PDE4D
• UniProt ID: Q08499
• Protein Sequence: Synthetic peptide located within the following region: FQFELTLEEDGESDTEKDSGSQVEEDTSCSDSKTLCTQDSESTEIPLDEQ
• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Buffer/Preservatives: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Alternative names: DPDE3, PDE43, STRK1, ACRDYS2, HSPDE4D, PDE4DN2
• Note: For research use only
• Expiration Date: 12 months from date of receipt.

Sample Tissue: Mouse Brain, Antibody dilution: 1 ug/ml.

Sample Tissue: Mouse Brain, Antibody dilution: 1 ug/ml.

Sample Type: Thymus Tumor lysates, Antibody dilution: 1.0 ug/ml.

Positive control (+): Hela (HL), Negative control (-): 293T (2T), Antibody concentration: 3 ug/ml.