You have no items in your shopping cart.
Cart summary
Item 1 of 4
Item 1 of 4
PDE1A Rabbit Polyclonal Antibody
Catalog Number: orb330717
| Catalog Number | orb330717 |
|---|---|
| Category | Antibodies |
| Description | Rabbit polyclonal antibody to PDE1A |
| Species/Host | Rabbit |
| Clonality | Polyclonal |
| Tested applications | WB |
| Predicted Reactivity | Canine, Mouse, Rat |
| Reactivity | Human |
| Immunogen | The immunogen is a synthetic peptide directed towards the C terminal region of human PDE1A |
| Concentration | 0.5 mg/ml |
| Form/Appearance | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Conjugation | Unconjugated |
| MW | 60kDa |
| Target | PDE1A |
| UniProt ID | P54750 |
| Protein Sequence | Synthetic peptide located within the following region: AVDLKSFKNNLVDIIQQNKERWKELAAQGESDLHKNSEDLVNAEEKHDET |
| NCBI | NP_005010 |
| Storage | Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles. |
| Buffer/Preservatives | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Alternative names | anti HCAM1 antibody, anti HSPDE1A antibody, anti M Read more... |
| Note | For research use only |
| Expiration Date | 12 months from date of receipt. |
Rabbit Anti-PDE1A antibody, Formalin Fixed Paraffin Embedded Tissue: Human Kidney, Primary antibody Concentration: 1:100, Secondary Antibody: Donkey anti-Rabbit-Cy3, Secondary Antibody Concentration: 1:200, Magnification: 20x, Exposure Time: 0.5-2.0 sec.
Rabbit Anti-PDE1A antibody, Formalin Fixed Paraffin Embedded Tissue: Human Liver, Primary antibody Concentration: 1:100, Secondary Antibody: Donkey anti-Rabbit-Cy3, Secondary Antibody Concentration: 1:200, Magnification: 20x, Exposure Time: 0.5-2.0 sec.
Rabbit Anti-PDE1A antibody, Formalin Fixed Paraffin Embedded Tissue: Human Thyroid, Primary antibody Concentration: 1:100, Secondary Antibody: Donkey anti-Rabbit-Cy3, Secondary Antibody Concentration: 1:200, Magnification: 20x, Exposure Time: 0.5-2.0 sec.
WB Suggested Anti-PDE1A Antibody Titration: 0.2-1 ug/ml, ELISA Titer: 1:312500, Positive Control: Jurkat cell lysate.
- Item 1 of 3
- Item 1 of 3
- Item 1 of 3
PDE1A Rabbit Polyclonal Antibody [orb312700]
IF, IHC-Fr, IHC-P, WB
Bovine, Canine, Equine, Porcine, Rabbit, Sheep
Human, Mouse, Rat
Rabbit
Polyclonal
Unconjugated
50 μl, 100 μl, 200 μl - Item 1 of 1
Anti-PDE1A Antibody [orb411778]
WB
Human, Mouse, Rat
Rabbit
Polyclonal
Unconjugated
200 μl, 50 μl, 100 μl - Item 1 of 1
