PDE12 Rabbit Polyclonal Antibody

SKU: orb582043

Description

Rabbit polyclonal antibody to PDE12

Research Area

Epigenetics

Images & Validation

• Tested Applications: WB
• Reactivity: Human
• Predicted Reactivity: Bovine, Canine, Equine, Guinea pig, Mouse, Rabbit, Rat, Zebrafish

Key Properties

• Host: Rabbit
• Clonality: Polyclonal
• Immunogen: The immunogen is a synthetic peptide directed towards the C-terminal region of human PDE12
• Target: PDE12
• Protein Sequence: Synthetic peptide located within the following region: FGLEGVFRIKQHEGLATFYRKSKFSLLSQHDISFYEALESDPLHKELLEK
• Molecular Weight: 51kDa
• Purification: Affinity Purified
• Conjugation: Unconjugated

Storage & Handling

• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Buffer/Preservatives: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Concentration: 0.5 mg/ml
• Expiration Date: 12 months from date of receipt.
• Disclaimer: For research use only

Alternative Names

2-PDE, 2'-PDE

Sample Type: Ovary Tumor lysates, Antibody dilution: 1.0 ug/ml.

WB Suggested Anti-PDE12 antibody Titration: 1 ug/ml, Sample Type: Human heart.

Quick Database Links

Gene Symbol

PDE12

UniProt

Q6L8Q7

RefSeq (Protein):NP_808881.3