PCSK1 Rabbit Polyclonal Antibody

SKU: orb574845

Description

Rabbit polyclonal antibody to PCSK1

Research Area

Neuroscience, Signal Transduction

Images & Validation

• Tested Applications: IHC, WB
• Reactivity: Human
• Predicted Reactivity: Bovine, Canine, Equine, Guinea pig, Mouse, Rabbit, Rat

Key Properties

• Host: Rabbit
• Clonality: Polyclonal
• Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human PCSK1
• Target: PCSK1
• Protein Sequence: Synthetic peptide located within the following region: QSPKKSPSAKLNIPYENFYEALEKLNKPSQLKDSEDSLYNDYVDVFYNTK
• Molecular Weight: 84 kDa
• Purification: Affinity Purified
• Conjugation: Unconjugated

Storage & Handling

• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Buffer/Preservatives: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Concentration: 0.5 mg/ml
• Expiration Date: 12 months from date of receipt.
• Disclaimer: For research use only

Alternative Names

PC1, PC3, NEC1, SPC3, BMIQ12

25 ug of the indicated Human whole cell extracts was loaded onto a 12% SDS-PAGE gel. 3 ug/ml of the antibody was used in this experiment. The protein may be modified by glycosylation.

Sample Tissue: Human Jurkat Whole Cell, Antibody dilution: 3 ug/ml.

Sample Tissue: Human PANC1 Whole Cell, Antibody dilution: 1 ug/ml.

Immunohistochemistry with Pancreas tissue at an antibody concentration of 5 ug/ml using anti-PCSK1 antibody (orb574845).

WB Suggested Anti-PCSK1 Antibody Titration: 0.2-1 ug/ml, ELISA Titer: 1:62500, Positive Control: Human Small Intestine.

Quick Database Links

Gene Symbol

PCSK1

UniProt

P29120

RefSeq (Protein):NP_000430