PCDH8 monoclonal antibody (M01), clone 6A8

• Catalog Number: orb2292446
• Category: Antibodies
• Description: Mouse monoclonal antibody raised against a partial recombinant PCDH8.
• Clonality: Monoclonal
• Species/Host: Mouse
• Isotype: IgG1 Kappa
• Conjugation: Unconjugated
• Reactivity: Human
• Buffer/Preservatives: In 1x PBS, pH 7.4
• Immunogen: PCDH8 (NP_002581, 32 a.a. ~ 120 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
• Protein Sequence: VRYSTFEEDAPGTVIGTLAEDLHMKVSGDTSFRLMKQFNSSLLRVREGDGQLTVGDAGLDRERLCGQAPQCVLAFDVVSFSQEQFRLVH
• Tested applications: ELISA, IHC-P, WB
• Clone Number: 6A8
• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Note: For research use only
• NCBI: NP_002581

Detection limit for recombinant GST tagged PCDH8 is approximately 0.1 ng/ml as a capture antibody.

Immunoperoxidase of monoclonal antibody to PCDH8 on formalin-fixed paraffin-embedded human tonsil. [antibody concentration 3 ug/ml]

PCDH8 monoclonal antibody (M01), clone 6A8 Western Blot analysis of PCDH8 expression in COLO 320 HSR.

Western Blot analysis of PCDH8 expression in transfected 293T cell line by PCDH8 monoclonal antibody (M01), clone 6A8. Lane 1: PCDH8 transfected lysate (113 KDa). Lane 2: Non-transfected lysate.

Western blot analysis of PCDH8 over-expressed 293 cell line, cotransfected with PCDH8 Validated Chimera RNAi (Lane 2) or non-transfected control (Lane 1). Blot probed with PCDH8 monoclonal antibody (M01), clone 6A8 (Cat # orb2292446). GAPDH (36.1 kDa) used as specificity and loading control.

Western Blot detection against Immunogen (35.53 KDa).