PC4/SUB1 Antibody

• Catalog Number: orb381100
• Category: Antibodies
• Description: PC4/SUB1 Antibody
• Species/Host: Rabbit
• Clonality: Polyclonal
• Tested applications: IF, IHC, WB
• Predicted Reactivity: Hamster
• Reactivity: Human, Mouse, Rat
• Isotype: Rabbit IgG
• Immunogen: A synthetic peptide corresponding to a sequence at the C-terminus of human PC4 (96-127aa MKPGRKGISLNPEQWSQLKEQISDIDDAVRKL), different from the related mouse and rat sequences by one amino acid.
• Concentration: Adding 0.2 ml of distilled water will yield a concentration of 500 μg/ml.
• Dilution range: Western blot, 0.1-0.5μg/ml, Human, Mouse, Rat Immunohistochemistry (Paraffin-embedded Section), 2-5μg/ml, Human, By Heat Immunofluorescence, 5 μg/ml, Human
• Form/Appearance: Lyophilized
• Conjugation: Unconjugated
• MW: 14395 MW
• UniProt ID: P53999
• Storage: Store at -20˚C for one year from date of receipt. After reconstitution, at 4˚C for one month. It can also be aliquotted and stored frozen at -20˚C for six months. Avoid repeated freeze-thaw cycles.
• Alternative names: Activated RNA polymerase II transcriptional coacti
• Note: For research use only
• Application notes: Tested Species: In-house tested species with positive results. By Heat: Boiling the paraffin sections in 10mM citrate buffer, pH6.0, for 20mins is required for the staining of formalin/paraffin sections. Other applications have not been tested. Optimal dilutions should be determined by end users. Add 0.2ml of distilled water will yield a concentration of 500ug/ml.
• Expiration Date: 12 months from date of receipt.

WB analysis of PC4/SUB1 using anti-PC4/SUB1 antibody.Lane 1:human HeLa cell; 2:human A549 cell; 3:human MCF-7 cell; 4:human T47D cell; 5:human PC-3 cell; 6:human Jurkat cell; 7:human placenta tissue; 8:human HL-60 cell.

WB analysis of PC4/SUB1 using anti-PC4/SUB1 antibody.Lane 1:rat liver tissue; 2:rat spleen tissue; 3:rat stomach tissue; 4:rat RH35 cell; 5:mouse liver tissue; 6:mosue spleen tissue.

IF analysis of PC4/SUB1 using anti-PC4/SUB1 antibody. PC4/SUB1 was detected in a paraffin-embedded section of human intestinal cancer tissue.

IHC analysis of PC4/SUB1 using anti-PC4/SUB1 antibody. PC4/SUB1 was detected in a paraffin-embedded section of human esophageal squamous carcinoma tissue.

IHC analysis of PC4/SUB1 using anti-PC4/SUB1 antibody. PC4/SUB1 was detected in a paraffin-embedded section of human endometrioid adenocarcinoma type I tissue.