PAX9 Rabbit Polyclonal Antibody

• Catalog Number: orb575006
• Category: Antibodies
• Description: Rabbit polyclonal antibody to PAX9
• Target: PAX9
• Clonality: Polyclonal
• Species/Host: Rabbit
• Conjugation: Unconjugated
• Reactivity: Human
• Predicted Reactivity: Bovine, Canine, Equine, Guinea pig, Mouse, Rabbit, Rat, Zebrafish
• Form/Appearance: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Concentration: 0.5 mg/ml
• Buffer/Preservatives: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Purification: Affinity Purified
• Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human PAX9
• Protein Sequence: Synthetic peptide located within the following region: LPGAIGGSKPRVTTPTVVKHIRTYKQRDPGIFAWEIRDRLLADGVCDKYN
• UniProt ID: P55771
• MW: 36kDa
• Tested applications: IHC, WB
• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Alternative names: STHAG3
• Research Area: Cell Biology, Epigenetics & Chromatin, Signal Tran
• Note: For research use only
• NCBI: NP_006185

Rabbit Anti-PAX9 Antibody, Paraffin Embedded Tissue: Human Brain, Cellular Data: Neural Cells, Antibody Concentration: 4.0-8.0 ug/ml, Magnification: 400X.

WB Suggested Anti-PAX9 Antibody Titration: 0.2-1 ug/ml, ELISA Titer: 1:62500, Positive Control: Jurkat cell lysate, PAX9 is supported by BioGPS gene expression data to be expressed in Jurkat.