Queen's Award Received in 2021 ISO 9001 Certified Delivered over 1,000,000 bio-reagents to life science researchers Trusted by Life Science Communities
Page Not Found
Cart summary

You have no items in your shopping cart.

PAX6 Rabbit Polyclonal Antibody

SKU: orb329958

Description

PAX6 Rabbit Polyclonal Antibody is an unconjugated, affinity purified antibody for the detection of PAX6. It is suitable for WB application. The immunogen is a synthetic peptide directed towards the N terminal region of human PAX6. This antibody reacts with Human, Mouse samples and is predicted to react with Bovine, Canine, Equine, Guinea pig, Porcine, Rabbit, Rat, Zebrafish. It is supplied as a liquid in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Research Area

Stem Cell & Developmental Biology

Images & Validation

Tested ApplicationsWB
ReactivityHuman, Mouse
Predicted ReactivityBovine, Canine, Equine, Guinea pig, Porcine, Rabbit, Rat, Zebrafish

Related Conjugates & Formulations

Key Properties

HostRabbit
ClonalityPolyclonal
ImmunogenThe immunogen is a synthetic peptide directed towards the N terminal region of human PAX6
TargetPAX6
Protein SequenceSynthetic peptide located within the following region: LAHSGARPCDISRILQTHADAKVQVLDNQNVSNGCVSKILGRYYETGSIR
Molecular Weight48kDa
PurificationAffinity Purified
ConjugationUnconjugated

Storage & Handling

StorageMaintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
Buffer/PreservativesLiquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Concentration0.5 mg/ml
Expiration Date12 months from date of receipt.
DisclaimerFor research use only

Alternative Names

anti AN antibody, anti AN2 antibody, anti MGDA antibody, anti WAGR antibody, anti D11S812E antibody

Similar Products

  • PAX6 Rabbit Polyclonal Antibody [orb158103]

    IHC-P,  WB

    Human, Mouse, Rat

    Rabbit

    Polyclonal

    Unconjugated

    100 μg
  • PAX6-T373 Antibody [orb1929706]

    IF,  IHC-P,  WB

    Human, Rat

    Rabbit

    Polyclonal

    Unconjugated

    50 μl, 100 μl
  • ELP4 Rabbit Polyclonal Antibody [orb183376]

    IF,  IHC-Fr,  IHC-P,  WB

    Rabbit

    Human, Mouse, Rat

    Rabbit

    Polyclonal

    Unconjugated

    50 μl, 100 μl, 200 μl
  • PAX6 Rabbit Polyclonal Antibody [orb612166]

    FC,  WB

    Bovine, Canine, Equine, Gallus, Rabbit, Sheep

    Human, Mouse, Rat

    Rabbit

    Polyclonal

    Unconjugated

    50 μl, 100 μl, 200 μl
  • PAX6 Antibody (Center) [orb1929707]

    FC,  IF,  IHC-P,  WB

    Mouse, Other, Rat

    Human

    Rabbit

    Polyclonal

    Unconjugated

    50 μl, 100 μl
Quality Guarantee

Quality Guarantee

Explore bioreagents carefree to elevate your research. All our products are rigorously tested for performance. If a product does not perform as described on its datasheet, our scientific support team will provide expert troubleshooting, a prompt replacement, or a refund. For full details, please see our Terms & Conditions and Buying Guide. Contact us at [email protected].

PAX6 Rabbit Polyclonal Antibody

Sample Tissue: Mouse Kidney, Antibody Dilution: 1 ug/mL.

PAX6 Rabbit Polyclonal Antibody

WB Suggested Anti-PAX6 Antibody Titration: 0.0625 ug/mL, ELISA Titer: 1:12500, Positive Control: HepG2 cell lysate.

UniProt Details

No UniProt data available

NCBI Reference Sequences

Associated Accession Numbers
Curated reference sequences for the gene transcript and protein product
ProteinNP_001595

Documents Download

Datasheet
Product Information
Download

Request a Document

Protocol Information

WB
Western Blot (IB, immunoblot)
View Protocol

PAX6 Rabbit Polyclonal Antibody (orb329958)

  • Star
  • Star
  • Star
  • Star
  • Star
  • 0.0
Based on 0 reviews

Participating in our Biorbyt product reviews program enables you to support fellow scientists by sharing your firsthand experience with our products.

Login to Submit a Review

No reviews yet

Available Sizes

Select a size below

100 μl
$ 620.00
Free Secondary Antibody (20 ul)0/0

Please add an antibody product to your cart first.

DispatchUsually dispatched within 1 - 2 weeks
Bulk Enquiry