PARP9 Rabbit Polyclonal Antibody

• Catalog Number: orb574820
• Category: Antibodies
• Description: Rabbit polyclonal antibody to PARP9
• Target: PARP9
• Clonality: Polyclonal
• Species/Host: Rabbit
• Conjugation: Unconjugated
• Reactivity: Human
• Predicted Reactivity: Human
• Form/Appearance: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Concentration: 0.5 mg/ml
• Buffer/Preservatives: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Purification: Affinity Purified
• Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human PARP9
• Protein Sequence: Synthetic peptide located within the following region: LHGGGLALALVKAGGFEIQEESKQFVARYGKVSAGEIAVTGAGRLPCKQI
• UniProt ID: Q8IXQ6
• MW: 96kDa
• Tested applications: WB
• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Alternative names: BAL, BAL1, ARTD9, MGC:7868
• Research Area: Cancer, DNA Damage, Epigenetics, Immunology
• Note: For research use only
• NCBI: NP_113646

Sample Tissue: Human NCI-H226 Whole Cell, Antibody dilution: 3 ug/ml.

WB Suggested Anti-PARP9 Antibody Titration: 0.2-1 ug/ml, ELISA Titer: 1:62500, Positive Control: Human brain.