You have no items in your shopping cart.
You have no items in your shopping cart.
Catalog Number | orb2291779 |
---|---|
Category | Antibodies |
Description | Mouse monoclonal antibody raised against a partial recombinant PAPSS2. |
Clonality | Monoclonal |
Species/Host | Mouse |
Isotype | IgG1 Kappa |
Conjugation | Unconjugated |
Reactivity | Human, Mouse |
Buffer/Preservatives | In 1x PBS, pH 7.4 |
Immunogen | PAPSS2 (NP_004661, 513 a.a. ~ 612 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
Protein Sequence | DPAGMPHPETKKDLYEPTHGGKVLSMAPGLTSVEIIPFRVAAYNKAKKAMDFYDPARHNEFDFISGTRMRKLAREGENPPDGFMAPKAWKVLTDYYRSLE |
Tested applications | ELISA, IF, IHC-P, WB |
Clone Number | 2A8 |
Storage | Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles. |
Note | For research use only |
NCBI | NP_004661 |
Detection limit for recombinant GST tagged PAPSS2 is approximately 0.03 ng/ml as a capture antibody.
Immunofluorescence of monoclonal antibody to PAPSS2 on A-431 cell. [antibody concentration 10 ug/ml]
Immunoperoxidase of monoclonal antibody to PAPSS2 on formalin-fixed paraffin-embedded human placenta. [antibody concentration 3 ug/ml]
PAPSS2 monoclonal antibody (M07), clone 2A8 Western Blot analysis of PAPSS2 expression in A-431.
PAPSS2 monoclonal antibody (M07), clone 2A8. Western Blot analysis of PAPSS2 expression in NIH/3T3.
Western Blot analysis of PAPSS2 expression in transfected 293T cell line by PAPSS2 monoclonal antibody (M07), clone 2A8. Lane 1: PAPSS2 transfected lysate (69.5 KDa). Lane 2: Non-transfected lysate.
Western blot analysis of PAPSS2 over-expressed 293 cell line, cotransfected with PAPSS2 Validated Chimera RNAi (Lane 2) or non-transfected control (Lane 1). Blot probed with PAPSS2 monoclonal antibody (M07), clone 2A8 (Cat # orb2291779). GAPDH (36.1 kDa) used as specificity and loading control.
Western Blot detection against Immunogen (36.74 KDa).