PAPSS2 monoclonal antibody (M07), clone 2A8

• Catalog Number: orb2291779
• Category: Antibodies
• Description: Mouse monoclonal antibody raised against a partial recombinant PAPSS2.
• Clonality: Monoclonal
• Species/Host: Mouse
• Isotype: IgG1 Kappa
• Conjugation: Unconjugated
• Reactivity: Human, Mouse
• Buffer/Preservatives: In 1x PBS, pH 7.4
• Immunogen: PAPSS2 (NP_004661, 513 a.a. ~ 612 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
• Protein Sequence: DPAGMPHPETKKDLYEPTHGGKVLSMAPGLTSVEIIPFRVAAYNKAKKAMDFYDPARHNEFDFISGTRMRKLAREGENPPDGFMAPKAWKVLTDYYRSLE
• Tested applications: ELISA, IF, IHC-P, WB
• Clone Number: 2A8
• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Note: For research use only
• NCBI: NP_004661

Detection limit for recombinant GST tagged PAPSS2 is approximately 0.03 ng/ml as a capture antibody.

Immunofluorescence of monoclonal antibody to PAPSS2 on A-431 cell. [antibody concentration 10 ug/ml]

Immunoperoxidase of monoclonal antibody to PAPSS2 on formalin-fixed paraffin-embedded human placenta. [antibody concentration 3 ug/ml]

PAPSS2 monoclonal antibody (M07), clone 2A8 Western Blot analysis of PAPSS2 expression in A-431.

PAPSS2 monoclonal antibody (M07), clone 2A8. Western Blot analysis of PAPSS2 expression in NIH/3T3.

Western Blot analysis of PAPSS2 expression in transfected 293T cell line by PAPSS2 monoclonal antibody (M07), clone 2A8. Lane 1: PAPSS2 transfected lysate (69.5 KDa). Lane 2: Non-transfected lysate.

Western blot analysis of PAPSS2 over-expressed 293 cell line, cotransfected with PAPSS2 Validated Chimera RNAi (Lane 2) or non-transfected control (Lane 1). Blot probed with PAPSS2 monoclonal antibody (M07), clone 2A8 (Cat # orb2291779). GAPDH (36.1 kDa) used as specificity and loading control.

Western Blot detection against Immunogen (36.74 KDa).