Cart summary

You have no items in your shopping cart.

PANX2 Rabbit Polyclonal Antibody

SKU: orb578596

Description

Rabbit polyclonal antibody to PANX2

Research Area

Cell Biology

Images & Validation

Tested ApplicationsIHC, WB
ReactivityHuman
Predicted ReactivityBovine, Canine, Equine, Guinea pig, Mouse, Rat, Zebrafish

Related Conjugates & Formulations

Key Properties

HostRabbit
ClonalityPolyclonal
ImmunogenThe immunogen is a synthetic peptide directed towards the N terminal region of human PANX2
TargetPANX2
Protein SequenceSynthetic peptide located within the following region: GTVLVPILLVTLVFTKNFAEEPIYCYTPHNFTRDQALYARGYCWTELRDA
Molecular Weight74 kDa
PurificationProtein A purified
ConjugationUnconjugated

Storage & Handling

StorageMaintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
Buffer/PreservativesLiquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Concentration1.0 mg/ml
Expiration Date12 months from date of receipt.
DisclaimerFor research use only

Alternative Names

PX2, hPANX2

Similar Products

Quality Guarantee

Quality Guarantee

Explore bioreagents carefree to elevate your research. All our products are rigorously tested for performance. If a product does not perform as described on its datasheet, our scientific support team will provide expert troubleshooting, a prompt replacement, or a refund. For full details, please see our Terms & Conditions and Buying Guide. Contact us at [email protected].

PANX2 Rabbit Polyclonal Antibody

25 ug of the indicated Human whole cell extracts was loaded onto a 12% SDS-PAGE gel. 3 ug/ml of the antibody was used in this experiment. Band appears higher due to modifications from glycosylation and phosphorylation.

PANX2 Rabbit Polyclonal Antibody

Sample Type: HepG2, Lane A: Primary Antibody, Lane B: Primary Antibody + Blocking Peptide, Primary Antibody Concentration: 2.5 ug/ml, Peptide Concentration: 2.0 ug/ml, Lysate Quantity: 25 ug/lane, Gel Concentration: 12%.

PANX2 Rabbit Polyclonal Antibody

Positive control (+): Human Liver (LI), Negative control (-): Human Lung (LU), Antibody concentration: 0.5 ug/ml.

PANX2 Rabbit Polyclonal Antibody

Human Muscle

PANX2 Rabbit Polyclonal Antibody

WB Suggested Anti-PANX2 Antibody Titration: 1.25 ug/ml, Positive Control: HepG2 cell lysate.

UniProt Details

No UniProt data available

NCBI Reference Sequences

Associated Accession Numbers
Curated reference sequences for the gene transcript and protein product
ProteinNP_443071

Documents Download

Datasheet
Product Information
Download

Request a Document

Protocol Information

WB
Western Blot (IB, immunoblot)
View Protocol
IHC
Immunohistochemistry
View Protocol

PANX2 Rabbit Polyclonal Antibody (orb578596)

  • Star
  • Star
  • Star
  • Star
  • Star
  • 0.0
Based on 0 reviews

Participating in our Biorbyt product reviews program enables you to support fellow scientists by sharing your firsthand experience with our products.

Login to Submit a Review

No reviews yet

Available Sizes

Select a size below

100 μl
$ 530.00
DispatchUsually dispatched within 3-7 working days
Bulk Enquiry