PACSIN1 Rabbit Polyclonal Antibody

• Catalog Number: orb331580
• Category: Antibodies
• Description: Rabbit polyclonal antibody to PACSIN1
• Target: PACSIN1
• Clonality: Polyclonal
• Species/Host: Rabbit
• Conjugation: Unconjugated
• Reactivity: Human
• Predicted Reactivity: Canine, Equine, Goat, Mouse, Porcine, Rabbit, Rat
• Form/Appearance: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Concentration: 1.0 mg/ml
• Buffer/Preservatives: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Purification: Protein A purified
• Immunogen: The immunogen is a synthetic peptide directed towards the C terminal region of human PACSIN1
• Protein Sequence: Synthetic peptide located within the following region: HTTTKKEKQPKKAEGVALTNATGAVESTSQAGDRGSVSSYDRGQPYATEW
• UniProt ID: Q5TZC3
• MW: 51kDa
• Tested applications: WB
• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Alternative names: anti KIAA1379 antibody, anti SDPI antibody
• Note: For research use only
• NCBI: NP_065855

WB Suggested Anti-PACSIN1 Antibody Titration: 2.5 ug/ml, ELISA Titer: 1:62500, Positive Control: Transfected 293T.