P2RX7 Rabbit Polyclonal Antibody

• Catalog Number: orb575527
• Category: Antibodies
• Description: Rabbit polyclonal antibody to P2RX7
• Species/Host: Rabbit
• Clonality: Polyclonal
• Tested applications: WB
• Predicted Reactivity: Bovine, Canine, Equine, Mouse, Porcine, Rabbit, Rat
• Reactivity: Human
• Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human P2RX7
• Concentration: 0.5 mg/ml
• Form/Appearance: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Conjugation: Unconjugated
• MW: 69kDa
• Target: P2RX7
• UniProt ID: Q99572
• Protein Sequence: Synthetic peptide located within the following region: VKEEIVENGVKKLVHSVFDTADYTFPLQGNSFFVMTNFLKTEGQEQRLCP
• NCBI: NP_803176
• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Buffer/Preservatives: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Alternative names: P2X7
• Note: For research use only
• Expiration Date: 12 months from date of receipt.

WB Suggested Anti-P2RX7 Antibody, Positive Control: Lane 1: 50 ug mock transfected HEK-293, Lane 2: 50 ug hP2X7 transfected HEK-293, Lane 3: 50 ug mP2X7 transfected HEK-293, Lane 4: 50 ug rP2X7 transfected HEK-293, Primary Antibody Dilution: 1:625, Secondary Antibody: Anti-rabbit-HRP, Secondry Antibody Dilution: 1:1000.

WB Suggested Anti-P2RX7 Antibody Titration: 0.2-1 ug/ml, ELISA Titer: 1:312500, Positive Control: Human heart.